(data stored in ACNUC7421 zone)

EMBL: AP009493.PE438

AP009493.PE438       Location/Qualifiers
FT   CDS             472865..473749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_438"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_438"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17267"
FT                   /db_xref="GOA:B1VQG6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG6"
FT                   /protein_id="BAG17267.1"
FT                   /translation="MSASTATSVPASAPADAAARRARRRSAALGVAAWVVGIGFCLPAL
FT                   WMVLTSFHAEADAATNPPSVAAALTLDGYRTFFGGGGGPTPWPPLVNSLAASFFSTVLV
FT                   LLLALPAAYALSIRRVRKWTDVMFFFLSTKMLPVVAGLLPVYLFAKNTGLLDNIWLLVL
FT                   LYTSMNLPIAVWMMQSFLADVPVSIIEAAQVDGARLPTVLRRVVAPVAGPGIAATALIC
FT                   FIFSWNELLFARVLTGVVAGTAPVHLTTFVTSQGLFLAQLCAASVVVSLPVLVAGYAAQ
FT                   DKLVQGLSLGAVK"
     MSASTATSVP ASAPADAAAR RARRRSAALG VAAWVVGIGF CLPALWMVLT SFHAEADAAT        60
     NPPSVAAALT LDGYRTFFGG GGGPTPWPPL VNSLAASFFS TVLVLLLALP AAYALSIRRV       120
     RKWTDVMFFF LSTKMLPVVA GLLPVYLFAK NTGLLDNIWL LVLLYTSMNL PIAVWMMQSF       180
     LADVPVSIIE AAQVDGARLP TVLRRVVAPV AGPGIAATAL ICFIFSWNEL LFARVLTGVV       240
     AGTAPVHLTT FVTSQGLFLA QLCAASVVVS LPVLVAGYAA QDKLVQGLSL GAVK             294
//

If you have problems or comments...

PBIL Back to PBIL home page