(data stored in ACNUC7421 zone)

EMBL: AP009493.PE44

AP009493.PE44        Location/Qualifiers
FT   CDS             complement(46172..46705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_44t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_44t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16873"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLX2"
FT                   /protein_id="BAG16873.1"
FT                   /translation="MSADARNVWGPLTEGLNIPRDLDLGDRARALNQLGVTPDAHRTLV
FT                   RTVNETLPQQEAGFLVSSRQWPVLAHRMHRMTQQNLPLAEHLARITPDTAPWRTGPLSN
FT                   IAARLLLAAHHALTTPLDQPLPTGPRVSTTAARSRSTTAVPDRTTPKQPAPVRPAVPAH
FT                   RQQTAPAARHARGR"
     MSADARNVWG PLTEGLNIPR DLDLGDRARA LNQLGVTPDA HRTLVRTVNE TLPQQEAGFL        60
     VSSRQWPVLA HRMHRMTQQN LPLAEHLARI TPDTAPWRTG PLSNIAARLL LAAHHALTTP       120
     LDQPLPTGPR VSTTAARSRS TTAVPDRTTP KQPAPVRPAV PAHRQQTAPA ARHARGR          177
//

If you have problems or comments...

PBIL Back to PBIL home page