(data stored in ACNUC7421 zone)

EMBL: AP009493.PE440

AP009493.PE440       Location/Qualifiers
FT   CDS             474732..475667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_440"
FT                   /product="putative sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17269"
FT                   /db_xref="GOA:B1VQG8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG8"
FT                   /protein_id="BAG17269.1"
FT                   /translation="MTDPGPSRAADPGAVLVLGEALVDLVPADGDTGVRAAQPGGGPAN
FT                   VAVGLARLGGRPSFVGGFGDDAFGARVASWLSGAGVDLSLSRRSSLPTALAVADPGDHG
FT                   NTYRFHLGDTATFELPDRAAEAGRFGAVYAGGLAAVVAPAADAVAATARAAAATGLLVV
FT                   DPNVREDRTLDPVASLGRLRELCSLARVVKASDEDLARLWPDASPEASCRALAAEGRLV
FT                   VMTRGPKGATAYVHDAPAVSVPAVPVRVVNTIGAGDAFMAGMLTWLGAEAGWDPALSAG
FT                   RTQAMLEYAAATAASVCARAGTEPTAPPGV"
     MTDPGPSRAA DPGAVLVLGE ALVDLVPADG DTGVRAAQPG GGPANVAVGL ARLGGRPSFV        60
     GGFGDDAFGA RVASWLSGAG VDLSLSRRSS LPTALAVADP GDHGNTYRFH LGDTATFELP       120
     DRAAEAGRFG AVYAGGLAAV VAPAADAVAA TARAAAATGL LVVDPNVRED RTLDPVASLG       180
     RLRELCSLAR VVKASDEDLA RLWPDASPEA SCRALAAEGR LVVMTRGPKG ATAYVHDAPA       240
     VSVPAVPVRV VNTIGAGDAF MAGMLTWLGA EAGWDPALSA GRTQAMLEYA AATAASVCAR       300
     AGTEPTAPPG V                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page