(data stored in ACNUC7421 zone)

EMBL: AP009493.PE441

AP009493.PE441       Location/Qualifiers
FT   CDS             complement(476025..476513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_441"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17270"
FT                   /db_xref="GOA:B1VQG9"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG9"
FT                   /protein_id="BAG17270.1"
FT                   /translation="MEGGPQGRWTESQENRSTSPMSLPSYPDSPYPGQPAADHDPYGGQ
FT                   APARTNGFAVAALVLGLIACLFFWTVVGGLLLGLLAVVFGIIAALRTRQGRAPRRVMAI
FT                   VGAAFGALGLIGSVIVLVVAVSVFDSQEFQNLEDCMNRANGQAAEDRCAEDFVDELTN"
     MEGGPQGRWT ESQENRSTSP MSLPSYPDSP YPGQPAADHD PYGGQAPART NGFAVAALVL        60
     GLIACLFFWT VVGGLLLGLL AVVFGIIAAL RTRQGRAPRR VMAIVGAAFG ALGLIGSVIV       120
     LVVAVSVFDS QEFQNLEDCM NRANGQAAED RCAEDFVDEL TN                          162
//

If you have problems or comments...

PBIL Back to PBIL home page