(data stored in ACNUC7421 zone)

EMBL: AP009493.PE442

AP009493.PE442       Location/Qualifiers
FT   CDS             complement(476540..477097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_442"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17271"
FT                   /db_xref="GOA:B1VQH0"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1VQH0"
FT                   /protein_id="BAG17271.1"
FT                   /translation="MHHPARELPFPDALRPGARPAPHPLLAPVTGYLGTWRGTGSGGYP
FT                   TLDADFSYAQEVTFSHDGRPFLAYEARAWLLDADGQPLRPSARETGWWRLQPDGRVEAL
FT                   ITQPTGIAEISVGHARDGAVDLATERVALAPTAKEVDATRRRYTLTDPDTLTFVHDLAA
FT                   VGRPLQHHLSARLRREAPGQGI"
     MHHPARELPF PDALRPGARP APHPLLAPVT GYLGTWRGTG SGGYPTLDAD FSYAQEVTFS        60
     HDGRPFLAYE ARAWLLDADG QPLRPSARET GWWRLQPDGR VEALITQPTG IAEISVGHAR       120
     DGAVDLATER VALAPTAKEV DATRRRYTLT DPDTLTFVHD LAAVGRPLQH HLSARLRREA       180
     PGQGI                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page