(data stored in ACNUC7421 zone)

EMBL: AP009493.PE446

AP009493.PE446       Location/Qualifiers
FT   CDS             complement(481572..482369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_446"
FT                   /product="putative siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_446"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17275"
FT                   /db_xref="GOA:B1VQH4"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQH4"
FT                   /protein_id="BAG17275.1"
FT                   /translation="MSTVATETHRNRRPGRMHVTTVRRARRITPGMVRLTLGGDDLSEF
FT                   VSNGSDQHVALYFYEPHVELPRPFTTEAARALLPTAKPRLRRYTIRDHRPELHEVEMDF
FT                   VLHGPGQLASGWAERVRPGDEVIWFGPSPAYPVAPVTDWTLLLGDETALPAIGAILEEL
FT                   PPGHRVLAAVEVADPAEEQPLPTPADATVTWLHRDGRDHGELLRRHATALHLPEGRGRV
FT                   WGGAERGVMRDLRHHFVHVRGLGRADTHLTAYWTQGETQDSEV"
     MSTVATETHR NRRPGRMHVT TVRRARRITP GMVRLTLGGD DLSEFVSNGS DQHVALYFYE        60
     PHVELPRPFT TEAARALLPT AKPRLRRYTI RDHRPELHEV EMDFVLHGPG QLASGWAERV       120
     RPGDEVIWFG PSPAYPVAPV TDWTLLLGDE TALPAIGAIL EELPPGHRVL AAVEVADPAE       180
     EQPLPTPADA TVTWLHRDGR DHGELLRRHA TALHLPEGRG RVWGGAERGV MRDLRHHFVH       240
     VRGLGRADTH LTAYWTQGET QDSEV                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page