(data stored in ACNUC7421 zone)

EMBL: AP009493.PE45

AP009493.PE45        Location/Qualifiers
FT   CDS             48328..50304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_45t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_45t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16874"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLX3"
FT                   /protein_id="BAG16874.1"
FT                   /translation="MNPPTVSARVRGRAAELERIGTLVRGRGGGMVVVCGAGGLGKTTL
FT                   AAEASARARAEGRVVVWIRWRDGAAQLGQDLAQAAHILGLPESRLEDARTGRVSLVDAV
FT                   WEHLATVKGWLIVVDNVDTPSRVGPGSGLPAAYRGWLRPHGGGVLLVTSRDTTRQTWGP
FT                   DADLIHLQPLADDAAGTVLLDAAAHAGTETEAEALAVRLGGLPLGLNAAGTYLSVPTSR
FT                   HRTFAAYQHALEAEFADLLGAEHPGAAADPDAARRVVRHTWDLSLDQLHQDCYALARPV
FT                   LQLLALLEPAPVPRSLVTPGLVTDATGLPATAATVDAALAGLHQYGLLHTPGDANPGDG
FT                   GPPVNQVRLHRLVRDVTAHTLTRPEPTDTWVAAIDEHLARAVDATTSMPGRTGWPTARL
FT                   LAVHLRSHLDRRAQRDFTTAVGTLDDLADALNNAGAASEELLLRRHLLDAETRLLGADH
FT                   PDTLATRNNLASTLNDLGEHQQAAVLHHQTLTARERILGPDHPNTLSSRNNYANVLNRL
FT                   GDHRQAAGLHRQDLTDRERVLGSHHPDTLGSRNNLATALNRLGDHRQAADLHRRNLTDS
FT                   ERILGPDHPNTLSSRNNLANALNALGEHQQAADLHHQTLTARERILGPNHPDTLTTRNN
FT                   LATAQARLAEVGRRRWWQLPRRR"
     MNPPTVSARV RGRAAELERI GTLVRGRGGG MVVVCGAGGL GKTTLAAEAS ARARAEGRVV        60
     VWIRWRDGAA QLGQDLAQAA HILGLPESRL EDARTGRVSL VDAVWEHLAT VKGWLIVVDN       120
     VDTPSRVGPG SGLPAAYRGW LRPHGGGVLL VTSRDTTRQT WGPDADLIHL QPLADDAAGT       180
     VLLDAAAHAG TETEAEALAV RLGGLPLGLN AAGTYLSVPT SRHRTFAAYQ HALEAEFADL       240
     LGAEHPGAAA DPDAARRVVR HTWDLSLDQL HQDCYALARP VLQLLALLEP APVPRSLVTP       300
     GLVTDATGLP ATAATVDAAL AGLHQYGLLH TPGDANPGDG GPPVNQVRLH RLVRDVTAHT       360
     LTRPEPTDTW VAAIDEHLAR AVDATTSMPG RTGWPTARLL AVHLRSHLDR RAQRDFTTAV       420
     GTLDDLADAL NNAGAASEEL LLRRHLLDAE TRLLGADHPD TLATRNNLAS TLNDLGEHQQ       480
     AAVLHHQTLT ARERILGPDH PNTLSSRNNY ANVLNRLGDH RQAAGLHRQD LTDRERVLGS       540
     HHPDTLGSRN NLATALNRLG DHRQAADLHR RNLTDSERIL GPDHPNTLSS RNNLANALNA       600
     LGEHQQAADL HHQTLTARER ILGPNHPDTL TTRNNLATAQ ARLAEVGRRR WWQLPRRR         658
//

If you have problems or comments...

PBIL Back to PBIL home page