(data stored in ACNUC7421 zone)

EMBL: AP009493.PE454

AP009493.PE454       Location/Qualifiers
FT   CDS             complement(535804..536871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_454"
FT                   /product="putative FecCD-family membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_454"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17283"
FT                   /db_xref="GOA:B1VQI2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI2"
FT                   /protein_id="BAG17283.1"
FT                   /translation="MTAPPAALGRRSAARKPPPEPTAVRSALRGGGLLVLTGLLLLLVV
FT                   LSTWIGTKDTTLGQVWTALWNDDGSYATDVIRQLRLPRTLVGLMTGAALGVAGAVMQAV
FT                   TRNPLADPGLLGVNAGASAAVVFGIGVVGLAGFGSLVWFSFVGAALTTVIVYVLGASGR
FT                   AGPTPVRLALAGAAVSASLSGVIAGLTVFDSATYDYLRFWMVGSLAGREPELVVQLLPF
FT                   VAIGLVIALLLARPLNSLALGEELGRALGARIARTRIAAVIAVTLLCGASTAAAGPIGF
FT                   VGLVVPLVARWLTGPDLRWVLPYSMLLAPVLLLVSDIIGRVALPGDELEVGAVTAVIGA
FT                   PVFIAMVCRRKEASL"
     MTAPPAALGR RSAARKPPPE PTAVRSALRG GGLLVLTGLL LLLVVLSTWI GTKDTTLGQV        60
     WTALWNDDGS YATDVIRQLR LPRTLVGLMT GAALGVAGAV MQAVTRNPLA DPGLLGVNAG       120
     ASAAVVFGIG VVGLAGFGSL VWFSFVGAAL TTVIVYVLGA SGRAGPTPVR LALAGAAVSA       180
     SLSGVIAGLT VFDSATYDYL RFWMVGSLAG REPELVVQLL PFVAIGLVIA LLLARPLNSL       240
     ALGEELGRAL GARIARTRIA AVIAVTLLCG ASTAAAGPIG FVGLVVPLVA RWLTGPDLRW       300
     VLPYSMLLAP VLLLVSDIIG RVALPGDELE VGAVTAVIGA PVFIAMVCRR KEASL            355
//

If you have problems or comments...

PBIL Back to PBIL home page