(data stored in ACNUC7421 zone)

EMBL: AP009493.PE458

AP009493.PE458       Location/Qualifiers
FT   CDS             complement(540264..540827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_458"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17287"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI6"
FT                   /protein_id="BAG17287.1"
FT                   /translation="MSTTALDDRRILAIVTNYGVEQDELVVPVKHLRAHGARVSVAAVS
FT                   ADGIRTLVGDRDPGETVRPDLTLDDVDPAAYDLLLVPGGTLNADSLRLEDATTRIVSSF
FT                   AASGRPVAAICHGPWALVEGGYVRGKTLTSYASLRTDITNAGGTWVDKPVVRDDAAGWP
FT                   LITSRNPGDLDDFLGEIDAVLDES"
     MSTTALDDRR ILAIVTNYGV EQDELVVPVK HLRAHGARVS VAAVSADGIR TLVGDRDPGE        60
     TVRPDLTLDD VDPAAYDLLL VPGGTLNADS LRLEDATTRI VSSFAASGRP VAAICHGPWA       120
     LVEGGYVRGK TLTSYASLRT DITNAGGTWV DKPVVRDDAA GWPLITSRNP GDLDDFLGEI       180
     DAVLDES                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page