(data stored in ACNUC7421 zone)

EMBL: AP009493.PE459

AP009493.PE459       Location/Qualifiers
FT   CDS             complement(540933..542024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_459"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17288"
FT                   /db_xref="GOA:B1VQI7"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI7"
FT                   /protein_id="BAG17288.1"
FT                   /translation="MVRTVGVEEELLLVDEVSGEARALSSAVLAIAEKEADGESAFESE
FT                   LHRQQVEFSTHPCASMEELAASVRRWRTEAVRHATEAGASVAALATSPLPVSPTIGTGE
FT                   RYRWLAERFGLTAQEQLTCGCHVHVSVASEEEGVAVLDRIRPWLPVLLALSANSPFWQG
FT                   QDSRYSSYRGQVWGRWPSAGPADVHGSAEAYHAQVRSLVATGVLRDEGMVYFDARLSHR
FT                   YPTVEVRIADVCLDPADTVLLATLVRGLVETAARAWRAGEPPGDVSTSLLRVASWQAGR
FT                   WGLEDRLVHPRTLCPEPASEVLRALLDQVREALEDSGDLADAERALAEVLRRGNGARIQ
FT                   REILARTGSLRDTVAECVRISAG"
     MVRTVGVEEE LLLVDEVSGE ARALSSAVLA IAEKEADGES AFESELHRQQ VEFSTHPCAS        60
     MEELAASVRR WRTEAVRHAT EAGASVAALA TSPLPVSPTI GTGERYRWLA ERFGLTAQEQ       120
     LTCGCHVHVS VASEEEGVAV LDRIRPWLPV LLALSANSPF WQGQDSRYSS YRGQVWGRWP       180
     SAGPADVHGS AEAYHAQVRS LVATGVLRDE GMVYFDARLS HRYPTVEVRI ADVCLDPADT       240
     VLLATLVRGL VETAARAWRA GEPPGDVSTS LLRVASWQAG RWGLEDRLVH PRTLCPEPAS       300
     EVLRALLDQV REALEDSGDL ADAERALAEV LRRGNGARIQ REILARTGSL RDTVAECVRI       360
     SAG                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page