(data stored in ACNUC7421 zone)

EMBL: AP009493.PE461

AP009493.PE461       Location/Qualifiers
FT   CDS             542618..542866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_461"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17290"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI9"
FT                   /protein_id="BAG17290.1"
FT                   /translation="MTDRRPEGTAYTGASGSPPPVPADMPDQQTQEGEDALDIPVPDRV
FT                   ARQGGQPELDEAGAGRNTPRNAGAHPERQPTPDESTG"
     MTDRRPEGTA YTGASGSPPP VPADMPDQQT QEGEDALDIP VPDRVARQGG QPELDEAGAG        60
     RNTPRNAGAH PERQPTPDES TG                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page