(data stored in ACNUC7421 zone)

EMBL: AP009493.PE463

AP009493.PE463       Location/Qualifiers
FT   CDS             complement(543783..544160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_463"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17292"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQJ1"
FT                   /protein_id="BAG17292.1"
FT                   /translation="MSRQRRSAVLLAAFMGGAGVLHFAAPKVFDDTVPRMLPGQPRTWT
FT                   YASGVVELALAAGLAHPGTRAVAARATAGFFVGVFPANVQMAVDWRHRPRPQRIAAWAR
FT                   LPLQAPLVLWARGVARGADGP"
     MSRQRRSAVL LAAFMGGAGV LHFAAPKVFD DTVPRMLPGQ PRTWTYASGV VELALAAGLA        60
     HPGTRAVAAR ATAGFFVGVF PANVQMAVDW RHRPRPQRIA AWARLPLQAP LVLWARGVAR       120
     GADGP                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page