(data stored in ACNUC7421 zone)

EMBL: AP009493.PE464

AP009493.PE464       Location/Qualifiers
FT   CDS             complement(544227..544544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_464"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17293"
FT                   /db_xref="GOA:B1VQJ2"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQJ2"
FT                   /protein_id="BAG17293.1"
FT                   /translation="MIRRFAAAFGRVAFPSALFTAAGYVLATRTPGPYQRLFEDQWDAI
FT                   LTGAAVTMCGVLASAYGVRLCFSVLGGFQPDNVRRGVLALVAGVLVGGVGLSLLWRLLA
FT                   L"
     MIRRFAAAFG RVAFPSALFT AAGYVLATRT PGPYQRLFED QWDAILTGAA VTMCGVLASA        60
     YGVRLCFSVL GGFQPDNVRR GVLALVAGVL VGGVGLSLLW RLLAL                       105
//

If you have problems or comments...

PBIL Back to PBIL home page