(data stored in ACNUC7421 zone)

EMBL: AP009493.PE465

AP009493.PE465       Location/Qualifiers
FT   CDS             complement(544541..544981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_465"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17294"
FT                   /db_xref="GOA:B1VQJ3"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQJ3"
FT                   /protein_id="BAG17294.1"
FT                   /translation="MAAIEDGAAFLRTLADAERRLAGVQALGARRRRVRRPRIASASLA
FT                   ALIPGILAVAAVAGGGPGSLLVAVGLSVAALSLAACVTLLLRIERPLKRRFVAEEQAMI
FT                   EEVNRMRELFTHIAERDRWEERLKRSVRERLSRFPVDGGSLR"
     MAAIEDGAAF LRTLADAERR LAGVQALGAR RRRVRRPRIA SASLAALIPG ILAVAAVAGG        60
     GPGSLLVAVG LSVAALSLAA CVTLLLRIER PLKRRFVAEE QAMIEEVNRM RELFTHIAER       120
     DRWEERLKRS VRERLSRFPV DGGSLR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page