(data stored in ACNUC7421 zone)

EMBL: AP009493.PE466

AP009493.PE466       Location/Qualifiers
FT   CDS             complement(544983..545846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_466"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17295"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQJ4"
FT                   /protein_id="BAG17295.1"
FT                   /translation="MPDVWENTRSRWESVRHAVDGGPAAGVVAATLHGRPGLSVNPIAV
FT                   TGEAGVGKSVLYDALTQSIRTGDHDSSRSPDIEKHATVLRFGSRRTRAAVTVIPGQLST
FT                   QREKALQDTMRGDASPHGIVHVVAWGHNRIWQRASQRDVHAALAADGDVDQEAVRNWHR
FT                   RKEVADFRLLVDEIIEGQAAQRLRWLIVAVSKCDLYWDRLDEARDYYIPGQAPRESPFA
FT                   LLMRDLENETSLRLSVLPMVSRLMRHQYLPGLPLGTSQLDDAQIGALRTYFGQELHSFI
FT                   TQRNGH"
     MPDVWENTRS RWESVRHAVD GGPAAGVVAA TLHGRPGLSV NPIAVTGEAG VGKSVLYDAL        60
     TQSIRTGDHD SSRSPDIEKH ATVLRFGSRR TRAAVTVIPG QLSTQREKAL QDTMRGDASP       120
     HGIVHVVAWG HNRIWQRASQ RDVHAALAAD GDVDQEAVRN WHRRKEVADF RLLVDEIIEG       180
     QAAQRLRWLI VAVSKCDLYW DRLDEARDYY IPGQAPRESP FALLMRDLEN ETSLRLSVLP       240
     MVSRLMRHQY LPGLPLGTSQ LDDAQIGALR TYFGQELHSF ITQRNGH                     287
//

If you have problems or comments...

PBIL Back to PBIL home page