(data stored in ACNUC7421 zone)

EMBL: AP009493.PE467

AP009493.PE467       Location/Qualifiers
FT   CDS             complement(545949..546347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_467"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17296"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQJ5"
FT                   /protein_id="BAG17296.1"
FT                   /translation="MGANADMVAFVLARLADEEHVALAAGGDRWRCPADVPGEVHDRTG
FT                   GVAFTVRGRGFDEHIALQDPARTLERIETNRVMLGEYVEVADLDTDRPAEDFRSGRAVG
FT                   LGFAVRQLAAEYAGHPDYQARWLPRFIQ"
     MGANADMVAF VLARLADEEH VALAAGGDRW RCPADVPGEV HDRTGGVAFT VRGRGFDEHI        60
     ALQDPARTLE RIETNRVMLG EYVEVADLDT DRPAEDFRSG RAVGLGFAVR QLAAEYAGHP       120
     DYQARWLPRF IQ                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page