(data stored in ACNUC7421 zone)

EMBL: AP009493.PE47

AP009493.PE47        Location/Qualifiers
FT   CDS             complement(50758..51168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_47t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_47t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16876"
FT                   /db_xref="GOA:B1VLX5"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLX5"
FT                   /protein_id="BAG16876.1"
FT                   /translation="MDPAIRAAIEITPAAGTRDRIVDITTTGRRTGRPRRIEIFFYRAA
FT                   GRTYLCSGTSGRPTSWYANLLAHPDFTFHLKQGIRSDIRARAVPVTDQEERRRILTEIV
FT                   TDLNQPHNPGTITQPTHLRDWLDSRLVRVTFP"
     MDPAIRAAIE ITPAAGTRDR IVDITTTGRR TGRPRRIEIF FYRAAGRTYL CSGTSGRPTS        60
     WYANLLAHPD FTFHLKQGIR SDIRARAVPV TDQEERRRIL TEIVTDLNQP HNPGTITQPT       120
     HLRDWLDSRL VRVTFP                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page