(data stored in ACNUC7421 zone)

EMBL: AP009493.PE473

AP009493.PE473       Location/Qualifiers
FT   CDS             551449..552342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_473"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17302"
FT                   /db_xref="GOA:B1VQK1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQK1"
FT                   /protein_id="BAG17302.1"
FT                   /translation="MDAVDRVSPAGAGTAGAGEARAGRGSRVVGLALACHPGPALAVTA
FT                   LACALALGSGLGGPRSALVTAAVLTGQLSVGWCNDAYDARRDADAGRRGKPAADGTVGA
FT                   RAVWVAAGVAFALCVPLSLACGVLAGTVHLAAVAAAWLYNLRLKATALSWLPYVAGFGA
FT                   LPATVALSVPGGPWPRWWTVTAGALLGFAAHLADTLPDIAADRAAGIRGLPHRLGDRGT
FT                   RLLLPVPLLGATAVLAFGPPGPVGAAGAAALVLAGAASLAGPALGRRRRKAALAGAVAV
FT                   AAVDLALLLARGVGGA"
     MDAVDRVSPA GAGTAGAGEA RAGRGSRVVG LALACHPGPA LAVTALACAL ALGSGLGGPR        60
     SALVTAAVLT GQLSVGWCND AYDARRDADA GRRGKPAADG TVGARAVWVA AGVAFALCVP       120
     LSLACGVLAG TVHLAAVAAA WLYNLRLKAT ALSWLPYVAG FGALPATVAL SVPGGPWPRW       180
     WTVTAGALLG FAAHLADTLP DIAADRAAGI RGLPHRLGDR GTRLLLPVPL LGATAVLAFG       240
     PPGPVGAAGA AALVLAGAAS LAGPALGRRR RKAALAGAVA VAAVDLALLL ARGVGGA          297
//

If you have problems or comments...

PBIL Back to PBIL home page