(data stored in ACNUC7421 zone)

EMBL: AP009493.PE474

AP009493.PE474       Location/Qualifiers
FT   CDS             552507..555458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_474"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_474"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17303"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR033801"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQK2"
FT                   /protein_id="BAG17303.1"
FT                   /translation="MRWKRRTGQSITGLLIAGLVSVGLLPVAASAAEATDLARGKPVAA
FT                   SGSHGGYPAANANDGKVDSYWESNGLPADLTVKLGADADLESVVIKLNPDPIWGGRTQD
FT                   IQVLGRSQNGTAFTSLRARAGYAFSPSGNQNTVTIPVDGRVADLQLKFFANTGAPGGQI
FT                   AEVQVLGTAAPNPDLTVSALSWSPTSPSETDEITVRGTVRNAGSAASPATTVNVSLGGV
FT                   VVGSAPVGPLVAGASAPVSVGVGKRPQGSYTVSALVDPTDTVVESDNTNNSRTTASPLV
FT                   VGQSPGPDLEVRSISSSPANPAVGAAVTFTVAVHNRGTSAVSAGTVTRLTVGSTTLNGT
FT                   TPAIAAGATANVAVSGSWTAASGGATLTATADATNQVAETNETNNTFARSIVVGRGAAV
FT                   PYTELEAENAAYRGTLLKSDAERTFGHTNFATESSGRESVRLNATGEYVEFTSTAPSNS
FT                   VVVRNSIPDAPGGGGREATISLYADGQFVRKLDLSSKHSWLYGNTDSPEGLTNTPGGDA
FT                   RRLFDESHALLTRTYPAGTKFRLQRDASDNASFYIIDLIDLEQVAAPSSQPSGCVSITT
FT                   YGAVANDGIDDTAAIQRAVTANQTGQIDCVWIPAGQWRQEQKILTDDPLDRGQWNQVGI
FT                   RDVTIRGAGMWHSQLYTLTPPHEAGGINHPHEGNFGFDIDENTQISDIAIFGSGTIRGG
FT                   DGNHEGGVALNGRFGKDTKISNVWIEHANVGVWAGRDFDNIQELWNPGDGVEFTGMRIR
FT                   NTYADGINFANGTRNSTVYNSSFRNTGDDALAVWSSKYVKNQSVDIGHDNSFRNNTIQL
FT                   PWRANGIAIYGGYGNKIENNLISDTMNYPAIMLATDHDPLPFSGQTLIANNGLYRTGGA
FT                   FWNEDQEFGAITLFPQNLPIPGVTIRDTDIIDSTYDGIQFKTGGGVMQDVKIENVRIDK
FT                   SNNGSGILAMGGARGNATLTNVTITNSRDGHVLIEPGSQFTVAGTPNGARAKR"
     MRWKRRTGQS ITGLLIAGLV SVGLLPVAAS AAEATDLARG KPVAASGSHG GYPAANANDG        60
     KVDSYWESNG LPADLTVKLG ADADLESVVI KLNPDPIWGG RTQDIQVLGR SQNGTAFTSL       120
     RARAGYAFSP SGNQNTVTIP VDGRVADLQL KFFANTGAPG GQIAEVQVLG TAAPNPDLTV       180
     SALSWSPTSP SETDEITVRG TVRNAGSAAS PATTVNVSLG GVVVGSAPVG PLVAGASAPV       240
     SVGVGKRPQG SYTVSALVDP TDTVVESDNT NNSRTTASPL VVGQSPGPDL EVRSISSSPA       300
     NPAVGAAVTF TVAVHNRGTS AVSAGTVTRL TVGSTTLNGT TPAIAAGATA NVAVSGSWTA       360
     ASGGATLTAT ADATNQVAET NETNNTFARS IVVGRGAAVP YTELEAENAA YRGTLLKSDA       420
     ERTFGHTNFA TESSGRESVR LNATGEYVEF TSTAPSNSVV VRNSIPDAPG GGGREATISL       480
     YADGQFVRKL DLSSKHSWLY GNTDSPEGLT NTPGGDARRL FDESHALLTR TYPAGTKFRL       540
     QRDASDNASF YIIDLIDLEQ VAAPSSQPSG CVSITTYGAV ANDGIDDTAA IQRAVTANQT       600
     GQIDCVWIPA GQWRQEQKIL TDDPLDRGQW NQVGIRDVTI RGAGMWHSQL YTLTPPHEAG       660
     GINHPHEGNF GFDIDENTQI SDIAIFGSGT IRGGDGNHEG GVALNGRFGK DTKISNVWIE       720
     HANVGVWAGR DFDNIQELWN PGDGVEFTGM RIRNTYADGI NFANGTRNST VYNSSFRNTG       780
     DDALAVWSSK YVKNQSVDIG HDNSFRNNTI QLPWRANGIA IYGGYGNKIE NNLISDTMNY       840
     PAIMLATDHD PLPFSGQTLI ANNGLYRTGG AFWNEDQEFG AITLFPQNLP IPGVTIRDTD       900
     IIDSTYDGIQ FKTGGGVMQD VKIENVRIDK SNNGSGILAM GGARGNATLT NVTITNSRDG       960
     HVLIEPGSQF TVAGTPNGAR AKR                                               983
//

If you have problems or comments...

PBIL Back to PBIL home page