(data stored in ACNUC7421 zone)

EMBL: AP009493.PE475

AP009493.PE475       Location/Qualifiers
FT   CDS             555577..556656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_475"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17304"
FT                   /db_xref="GOA:B1VQK3"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQK3"
FT                   /protein_id="BAG17304.1"
FT                   /translation="MIPTVVWGTGNVGRAAIRAVEAHPALTLAAVLVHDPAKVGRDAGE
FT                   LGGVGRMLGVAATDDVAAALAARPRAVVYAASGDIRPDDALADIGRAIRSGAVVVTPSL
FT                   YPLYDQRNAPAELRDPVLAAVAEGGGSLFVSGVDPGWGNDVLPLLVSGLGTEVDVIRCQ
FT                   EIFDYSTYEQEESVRHLIGMGHPMEYEPLMLAPSVPTMVWGGQIRLMARALDVEVDEIR
FT                   ETMDRRALESTVGTRTMGEFAAGTQGAVRFEVQGIVGGVPRIVIEHITRIHPSCAPDWP
FT                   SPPDGVGAHRVVIEGRPRIEVTVEASDEDKNRSAGGNATAVGRLVSAIDWLVDAEPGLY
FT                   DALDVPLRPAVGRLGRRPA"
     MIPTVVWGTG NVGRAAIRAV EAHPALTLAA VLVHDPAKVG RDAGELGGVG RMLGVAATDD        60
     VAAALAARPR AVVYAASGDI RPDDALADIG RAIRSGAVVV TPSLYPLYDQ RNAPAELRDP       120
     VLAAVAEGGG SLFVSGVDPG WGNDVLPLLV SGLGTEVDVI RCQEIFDYST YEQEESVRHL       180
     IGMGHPMEYE PLMLAPSVPT MVWGGQIRLM ARALDVEVDE IRETMDRRAL ESTVGTRTMG       240
     EFAAGTQGAV RFEVQGIVGG VPRIVIEHIT RIHPSCAPDW PSPPDGVGAH RVVIEGRPRI       300
     EVTVEASDED KNRSAGGNAT AVGRLVSAID WLVDAEPGLY DALDVPLRPA VGRLGRRPA        359
//

If you have problems or comments...

PBIL Back to PBIL home page