(data stored in ACNUC7421 zone)

EMBL: AP009493.PE476

AP009493.PE476       Location/Qualifiers
FT   CDS             556653..557132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_476"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17305"
FT                   /db_xref="GOA:B1VQK4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQK4"
FT                   /protein_id="BAG17305.1"
FT                   /translation="MIIDIPEGQEPIGYVWGEMVPGIGMAAATFSMSVYEHTTLGLREF
FT                   EAARLRVAQINGCLFCLDWRTERDGAKVEEEFAGAVTEWRTTDAFDERTRLAAEYAERY
FT                   TLDHHGLDDAFWQRMTAHYSQAEIVELTMSIGSWLAFGRLNHVLGIDAVCVLPGH"
     MIIDIPEGQE PIGYVWGEMV PGIGMAAATF SMSVYEHTTL GLREFEAARL RVAQINGCLF        60
     CLDWRTERDG AKVEEEFAGA VTEWRTTDAF DERTRLAAEY AERYTLDHHG LDDAFWQRMT       120
     AHYSQAEIVE LTMSIGSWLA FGRLNHVLGI DAVCVLPGH                              159
//

If you have problems or comments...

PBIL Back to PBIL home page