(data stored in ACNUC7421 zone)

EMBL: AP009493.PE478

AP009493.PE478       Location/Qualifiers
FT   CDS             complement(559010..559852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_478"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17307"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQK6"
FT                   /protein_id="BAG17307.1"
FT                   /translation="MPAQGKHRRSPSTSLRRGLAAVTAGGAVLALPVIGATSAFAAPAP
FT                   TAAPQQSVAPAAVAPANSVAKAAPAQHSVAAGETLSKIAREYSVSGGWEKLYEGNRKII
FT                   GANPDLIHPGIKLTLGTVADASSGGTADKAAKASPSAARGAEADRADRSERIDAAPVAK
FT                   TAPAAEKAVTYTNDLDGWIKESLAIMAEQGIPGTYEGIHRNIMRESSGNPAAINNWDSN
FT                   AVKGTPSKGLLQVIDPTFQAYHVPGTSTDSYDPVANITAACNYAADRYGSIDNVFGAY"
     MPAQGKHRRS PSTSLRRGLA AVTAGGAVLA LPVIGATSAF AAPAPTAAPQ QSVAPAAVAP        60
     ANSVAKAAPA QHSVAAGETL SKIAREYSVS GGWEKLYEGN RKIIGANPDL IHPGIKLTLG       120
     TVADASSGGT ADKAAKASPS AARGAEADRA DRSERIDAAP VAKTAPAAEK AVTYTNDLDG       180
     WIKESLAIMA EQGIPGTYEG IHRNIMRESS GNPAAINNWD SNAVKGTPSK GLLQVIDPTF       240
     QAYHVPGTST DSYDPVANIT AACNYAADRY GSIDNVFGAY                             280
//

If you have problems or comments...

PBIL Back to PBIL home page