(data stored in ACNUC7421 zone)

EMBL: AP009493.PE480

AP009493.PE480       Location/Qualifiers
FT   CDS             complement(561876..564524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17309"
FT                   /db_xref="GOA:B1VQK8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQK8"
FT                   /protein_id="BAG17309.1"
FT                   /translation="MRGTPHREHAGCVTRHETPRHPPPAGNGAAAGGDEGGRVPDELSL
FT                   VLAQGLVSAVESSDGFAGGVYLRSRTPGLLRLAVLAGLPGPLFRPWWRMQVNRPFPVSE
FT                   AYRSGRPVLLSDAEEAMRRFPQLMAGLPFPFGSLWVPITGPRGSMGVLAILRASTPGRP
FT                   VAPADGDRLHRLGHRLGDALTDLDQRGVDCVWETEPVPVQLPAAATPPVRVGRFDWDLH
FT                   SGKVTADDELCAILGFEPAAFPGTVDALAARLVPEDVYGLWALARQTVESAEPVVRRMR
FT                   LRGPDGRSHLLELSGRWTHPDGDASASRLSGFLVDLGAGPVVPEAADRLPRGILSLDRL
FT                   GRITYANGLAEELLGHSREELVGHVVWQALPWFGHEAYEDHYRAALMADEPVHFLARRP
FT                   PSLWLSVSLYPGHDGVSVVLQSTDRPDYTPGSVTAPGLGIGSTADRSSALYRPVALAIA
FT                   LTEAVTARQVSEVVTEELLPAFGGRQLAIYLLDEGHLHLAWETGFPKGFLDRFEGVELD
FT                   VSIPGVETLTTGRPMFFESMQRLAEAYPGIPIDTDVGARAFLPLIASGRPVGSCILGFD
FT                   RPRGFSPEERTVLTALAGLIAQALKRAQRYDSESALARGLQNALLPHRLPEVDGVDTLG
FT                   RYLSGTQGMDVGGDWYDVIETGSELALVIGDVQGHGVAAAATMGQLRSAVRAFALNNYD
FT                   PQEVISGTNRLLIDLDPGQFASCCYIALDPLTGVARAVRAGHPQPVLRRPDGRTEVLDL
FT                   PGGIVLGIDEQASYPVTEMRLEPGAMLALFTDGLIERPGTDIDEGIERLRATVEHIGAV
FT                   PLAETADQVIGEARAATDRPDDIALLLASRWAGTRAVRRLRKDRAPGPDLWRTFRRPDP
FT                   GRAAGAPDPAS"
     MRGTPHREHA GCVTRHETPR HPPPAGNGAA AGGDEGGRVP DELSLVLAQG LVSAVESSDG        60
     FAGGVYLRSR TPGLLRLAVL AGLPGPLFRP WWRMQVNRPF PVSEAYRSGR PVLLSDAEEA       120
     MRRFPQLMAG LPFPFGSLWV PITGPRGSMG VLAILRASTP GRPVAPADGD RLHRLGHRLG       180
     DALTDLDQRG VDCVWETEPV PVQLPAAATP PVRVGRFDWD LHSGKVTADD ELCAILGFEP       240
     AAFPGTVDAL AARLVPEDVY GLWALARQTV ESAEPVVRRM RLRGPDGRSH LLELSGRWTH       300
     PDGDASASRL SGFLVDLGAG PVVPEAADRL PRGILSLDRL GRITYANGLA EELLGHSREE       360
     LVGHVVWQAL PWFGHEAYED HYRAALMADE PVHFLARRPP SLWLSVSLYP GHDGVSVVLQ       420
     STDRPDYTPG SVTAPGLGIG STADRSSALY RPVALAIALT EAVTARQVSE VVTEELLPAF       480
     GGRQLAIYLL DEGHLHLAWE TGFPKGFLDR FEGVELDVSI PGVETLTTGR PMFFESMQRL       540
     AEAYPGIPID TDVGARAFLP LIASGRPVGS CILGFDRPRG FSPEERTVLT ALAGLIAQAL       600
     KRAQRYDSES ALARGLQNAL LPHRLPEVDG VDTLGRYLSG TQGMDVGGDW YDVIETGSEL       660
     ALVIGDVQGH GVAAAATMGQ LRSAVRAFAL NNYDPQEVIS GTNRLLIDLD PGQFASCCYI       720
     ALDPLTGVAR AVRAGHPQPV LRRPDGRTEV LDLPGGIVLG IDEQASYPVT EMRLEPGAML       780
     ALFTDGLIER PGTDIDEGIE RLRATVEHIG AVPLAETADQ VIGEARAATD RPDDIALLLA       840
     SRWAGTRAVR RLRKDRAPGP DLWRTFRRPD PGRAAGAPDP AS                          882
//

If you have problems or comments...

PBIL Back to PBIL home page