(data stored in ACNUC7421 zone)

EMBL: AP009493.PE481

AP009493.PE481       Location/Qualifiers
FT   CDS             complement(564571..565188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_481"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17310"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQK9"
FT                   /protein_id="BAG17310.1"
FT                   /translation="MRTLRTAVLTAAAAALAVTALAPVPAAAAPAPAPVQPKFLSAGQL
FT                   PASATPWTAGPVRQGTPAEGSVCTAGIAPASGTRHRDFRTELDTGARQTITLAPTTARA
FT                   KALAAELRSALETCLDRLKEQNPGLEGEAFYQGRVDIEEGAHVYSIDTSYPEVGSTDIG
FT                   LYSVGRDGRAVTVVEWGQLGELDGAPLEGFTNTTRTAVAKLY"
     MRTLRTAVLT AAAAALAVTA LAPVPAAAAP APAPVQPKFL SAGQLPASAT PWTAGPVRQG        60
     TPAEGSVCTA GIAPASGTRH RDFRTELDTG ARQTITLAPT TARAKALAAE LRSALETCLD       120
     RLKEQNPGLE GEAFYQGRVD IEEGAHVYSI DTSYPEVGST DIGLYSVGRD GRAVTVVEWG       180
     QLGELDGAPL EGFTNTTRTA VAKLY                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page