(data stored in ACNUC7421 zone)

EMBL: AP009493.PE482

AP009493.PE482       Location/Qualifiers
FT   CDS             565377..566933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_482"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17311"
FT                   /db_xref="GOA:B1VQL0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQL0"
FT                   /protein_id="BAG17311.1"
FT                   /translation="MGVLGGLERPGTAVGRSSVTGGAEGSARVVLAERLSALRERSGRT
FT                   YASLARRIGVSGSTLHRYCTGRTVPAEFAPVERLARLCGAPAGEREALHRLWILADRER
FT                   LDRQAAEGGAEGEADAAAEATDVGPVDGSAGRRAAGPHASGAGPSGSAGSGTPPSALPG
FT                   PLGRPGPRPGPGPAVGRVAAIGSGTPRGPASRSRRARRYGPGLGVLAAGALAVALVAAL
FT                   GGTSPPAPDRGPSVAQRPGGPPSGSPDPSVSGSPAPRTPRATAGGTDRATPSGGTGPAT
FT                   VPPGVEQRSKALPRASGGSPSAKAGRVPFTWSADAHVWKNGCDHSYLLDRVPTAVPPPP
FT                   VEADAESWAGALGAVHAGEAGVRITLQGRDERAVVLEALRIQVVERRSPAPGRVYRMSS
FT                   GCGGSLTPRMFDVDLDAPRPTARPVAGNDSGEPIAAVSFPYSVSVTDPEVLLITARAVG
FT                   CDCDWYAELTWSSGGRSGTVRVDDGGRPFRTSGTGGRPVFDYDTATGRWVSVPDAGEAA
FT                   S"
     MGVLGGLERP GTAVGRSSVT GGAEGSARVV LAERLSALRE RSGRTYASLA RRIGVSGSTL        60
     HRYCTGRTVP AEFAPVERLA RLCGAPAGER EALHRLWILA DRERLDRQAA EGGAEGEADA       120
     AAEATDVGPV DGSAGRRAAG PHASGAGPSG SAGSGTPPSA LPGPLGRPGP RPGPGPAVGR       180
     VAAIGSGTPR GPASRSRRAR RYGPGLGVLA AGALAVALVA ALGGTSPPAP DRGPSVAQRP       240
     GGPPSGSPDP SVSGSPAPRT PRATAGGTDR ATPSGGTGPA TVPPGVEQRS KALPRASGGS       300
     PSAKAGRVPF TWSADAHVWK NGCDHSYLLD RVPTAVPPPP VEADAESWAG ALGAVHAGEA       360
     GVRITLQGRD ERAVVLEALR IQVVERRSPA PGRVYRMSSG CGGSLTPRMF DVDLDAPRPT       420
     ARPVAGNDSG EPIAAVSFPY SVSVTDPEVL LITARAVGCD CDWYAELTWS SGGRSGTVRV       480
     DDGGRPFRTS GTGGRPVFDY DTATGRWVSV PDAGEAAS                               518
//

If you have problems or comments...

PBIL Back to PBIL home page