(data stored in ACNUC7421 zone)

EMBL: AP009493.PE488

AP009493.PE488       Location/Qualifiers
FT   CDS             complement(569903..570292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_488"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17317"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQL6"
FT                   /protein_id="BAG17317.1"
FT                   /translation="MLAAMEQREVVKRVIGILTEAREMQRLLEADLEREDLDAGAGAVT
FT                   ALLNETMPHIAIPDDFSVEEVVTVVGREVGGAVEQLVSAFTLAFTMLAQVHDSGQTDVS
FT                   SADVLQDLALRVEGGGPDDDENPLL"
     MLAAMEQREV VKRVIGILTE AREMQRLLEA DLEREDLDAG AGAVTALLNE TMPHIAIPDD        60
     FSVEEVVTVV GREVGGAVEQ LVSAFTLAFT MLAQVHDSGQ TDVSSADVLQ DLALRVEGGG       120
     PDDDENPLL                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page