(data stored in ACNUC7421 zone)

EMBL: AP009493.PE489

AP009493.PE489       Location/Qualifiers
FT   CDS             570380..570745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_489"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17318"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQL7"
FT                   /protein_id="BAG17318.1"
FT                   /translation="MERDPNSPAVELTPAAAGLLRRLRADHGPLMFHQSGGCCDGSAPM
FT                   CYPAGEFRTGNADVLLADLAVEGMSESVPFWMSRSQYEVWSHTRLIVDVVEGRGSGFSL
FT                   EAPEGVRFLIRSRLVDG"
     MERDPNSPAV ELTPAAAGLL RRLRADHGPL MFHQSGGCCD GSAPMCYPAG EFRTGNADVL        60
     LADLAVEGMS ESVPFWMSRS QYEVWSHTRL IVDVVEGRGS GFSLEAPEGV RFLIRSRLVD       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page