(data stored in ACNUC7421 zone)

EMBL: AP009493.PE493

AP009493.PE493       Location/Qualifiers
FT   CDS             complement(573704..574582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_493"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17322"
FT                   /db_xref="GOA:B1VQM1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR039559"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM1"
FT                   /protein_id="BAG17322.1"
FT                   /translation="MAHPTRRRALTVALATAAVAVAAPTATAVAAPARPSGPRPLRHAH
FT                   AHNDYLHPRPLRDALAHGFTSAEADVFLVGGDLLVAHEPATLDPTRTLASLYLEPLAAL
FT                   VRAGHGSVHPHHRAPLQLLIDIKADGVAAYRELDRQLRRHHRMLTRYRHGRVHPGAVTP
FT                   VISGDRAARAPMEAQHTRYAFYDGRLDDLGTAAPASFAPLVSANWTQTFGWLGAGPFPR
FT                   AERDRLRALVATAHREGRRIRFWATPDLPGPARDAVWSELLAAGVDHLNTDDLAGLERF
FT                   LRAHGAGAPTP"
     MAHPTRRRAL TVALATAAVA VAAPTATAVA APARPSGPRP LRHAHAHNDY LHPRPLRDAL        60
     AHGFTSAEAD VFLVGGDLLV AHEPATLDPT RTLASLYLEP LAALVRAGHG SVHPHHRAPL       120
     QLLIDIKADG VAAYRELDRQ LRRHHRMLTR YRHGRVHPGA VTPVISGDRA ARAPMEAQHT       180
     RYAFYDGRLD DLGTAAPASF APLVSANWTQ TFGWLGAGPF PRAERDRLRA LVATAHREGR       240
     RIRFWATPDL PGPARDAVWS ELLAAGVDHL NTDDLAGLER FLRAHGAGAP TP               292
//

If you have problems or comments...

PBIL Back to PBIL home page