(data stored in ACNUC7421 zone)

EMBL: AP009493.PE494

AP009493.PE494       Location/Qualifiers
FT   CDS             complement(574799..575479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_494"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_494"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17323"
FT                   /db_xref="GOA:B1VQM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM2"
FT                   /protein_id="BAG17323.1"
FT                   /translation="MLELTGITAGYDRRDPVVRDVSLRVAAGEAVGLLGPSGCGKSTLA
FT                   KVAALLHRPDAGTMTLDGTVIRGWRHRAPRERRTAVGVVFQQPRLSADPRLSLRELIAQ
FT                   PLRSTGRRRDVPERVAELAPLVGLSEELLERRPHAVSDGQLQRACLARALVLEPRLLIC
FT                   DEMTAMLDASTTAALVAVVERYRAASGASLLAVGHDRVLLERWCDRTVRWGEPSNGSER
FT                   PAVG"
     MLELTGITAG YDRRDPVVRD VSLRVAAGEA VGLLGPSGCG KSTLAKVAAL LHRPDAGTMT        60
     LDGTVIRGWR HRAPRERRTA VGVVFQQPRL SADPRLSLRE LIAQPLRSTG RRRDVPERVA       120
     ELAPLVGLSE ELLERRPHAV SDGQLQRACL ARALVLEPRL LICDEMTAML DASTTAALVA       180
     VVERYRAASG ASLLAVGHDR VLLERWCDRT VRWGEPSNGS ERPAVG                      226
//

If you have problems or comments...

PBIL Back to PBIL home page