(data stored in ACNUC7421 zone)

EMBL: AP009493.PE495

AP009493.PE495       Location/Qualifiers
FT   CDS             complement(575472..576473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_495"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_495"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17324"
FT                   /db_xref="GOA:B1VQM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM3"
FT                   /protein_id="BAG17324.1"
FT                   /translation="MTADRENTAVPVLDVRDLSVRFRMRGGRDIAAVTDARFTVAPGEC
FT                   LALVGESGCGKSVLASALLGLLPANAATTGSAVLGGDTDLLTADERTLARTVRGRRIGL
FT                   VPQSPAAHLTPVRTVRAQLEESLRELTGARGSELPKAAVEAAARASFPEGHLDRYPHEL
FT                   SGGLAQRAATALALVGDAPLLLADEPTTGLDRDLVERTVDELRRHTDEGRALLIITHDL
FT                   AAAERIADRVAVMYAGRIVEIAKAASFFGAPGPRHPYARGLLNALPERDFTPIPGMPPE
FT                   LGALPEGCAFAARCAHADTRCTGERPAFTAGLACHHAPTGRAHAATKESADA"
     MTADRENTAV PVLDVRDLSV RFRMRGGRDI AAVTDARFTV APGECLALVG ESGCGKSVLA        60
     SALLGLLPAN AATTGSAVLG GDTDLLTADE RTLARTVRGR RIGLVPQSPA AHLTPVRTVR       120
     AQLEESLREL TGARGSELPK AAVEAAARAS FPEGHLDRYP HELSGGLAQR AATALALVGD       180
     APLLLADEPT TGLDRDLVER TVDELRRHTD EGRALLIITH DLAAAERIAD RVAVMYAGRI       240
     VEIAKAASFF GAPGPRHPYA RGLLNALPER DFTPIPGMPP ELGALPEGCA FAARCAHADT       300
     RCTGERPAFT AGLACHHAPT GRAHAATKES ADA                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page