(data stored in ACNUC7421 zone)

EMBL: AP009493.PE496

AP009493.PE496       Location/Qualifiers
FT   CDS             complement(576470..577327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_496"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_496"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17325"
FT                   /db_xref="GOA:B1VQM4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM4"
FT                   /protein_id="BAG17325.1"
FT                   /translation="MAETALARPGRATRRVRVVTSAVIVTAVALAVLVVPPLAQLDQQA
FT                   VDLANKLDPPSLAHPFGTDDVGRDLLLRCVYGLRVSLLVGLVAALTATVIGTAIGALAG
FT                   AFGGWTDRIVMRVVDALSSIPHLLLGIFIVAMFRPGVWPVIVSVALTHWISTARIVRSE
FT                   VLSLRSRPFIDAAVSGGASRTRVVVRHLLPGVLPQAGLAAVLMVPHAMWHESALSFLGL
FT                   GLPAHQASLGNLVQSARGSLLAGDWWPTLFPGLFLIIPTLALAGLAGAWRDRINPRRKS
FT                   ELML"
     MAETALARPG RATRRVRVVT SAVIVTAVAL AVLVVPPLAQ LDQQAVDLAN KLDPPSLAHP        60
     FGTDDVGRDL LLRCVYGLRV SLLVGLVAAL TATVIGTAIG ALAGAFGGWT DRIVMRVVDA       120
     LSSIPHLLLG IFIVAMFRPG VWPVIVSVAL THWISTARIV RSEVLSLRSR PFIDAAVSGG       180
     ASRTRVVVRH LLPGVLPQAG LAAVLMVPHA MWHESALSFL GLGLPAHQAS LGNLVQSARG       240
     SLLAGDWWPT LFPGLFLIIP TLALAGLAGA WRDRINPRRK SELML                       285
//

If you have problems or comments...

PBIL Back to PBIL home page