(data stored in ACNUC7421 zone)

EMBL: AP009493.PE497

AP009493.PE497       Location/Qualifiers
FT   CDS             complement(577320..578312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_497"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_497"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17326"
FT                   /db_xref="GOA:B1VQM5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM5"
FT                   /protein_id="BAG17326.1"
FT                   /translation="MSRRLPWGPMARMAGRRALSAVPVLGVVTFGVFAVAAASPFDPVK
FT                   AYAGTAGLTASQENLDQLRANLGVDQPLVARWWDWLTSALRGDLGDSSVMRQPVADVIA
FT                   ERMGWSVLLAATAFLVAILLGTGLGVLAARRPGGWLDRCVSSVAYTLEAAPAFWLGLLA
FT                   IWFFALKLDVLPAGGLTDAASDVVTFGQVGSHLVLPAAVLGISQLPWFFLYVRQGVADA
FT                   LAEDPVRGARARGLSERTVLLGHALRSGMLPMLTLIGSRVPELITGALLVETVFSWPGI
FT                   AAATVQAATSVDFSLLAALTVLATAAVLLGNLISDLLYGLADPRVAFDG"
     MSRRLPWGPM ARMAGRRALS AVPVLGVVTF GVFAVAAASP FDPVKAYAGT AGLTASQENL        60
     DQLRANLGVD QPLVARWWDW LTSALRGDLG DSSVMRQPVA DVIAERMGWS VLLAATAFLV       120
     AILLGTGLGV LAARRPGGWL DRCVSSVAYT LEAAPAFWLG LLAIWFFALK LDVLPAGGLT       180
     DAASDVVTFG QVGSHLVLPA AVLGISQLPW FFLYVRQGVA DALAEDPVRG ARARGLSERT       240
     VLLGHALRSG MLPMLTLIGS RVPELITGAL LVETVFSWPG IAAATVQAAT SVDFSLLAAL       300
     TVLATAAVLL GNLISDLLYG LADPRVAFDG                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page