(data stored in ACNUC7421 zone)

EMBL: AP009493.PE498

AP009493.PE498       Location/Qualifiers
FT   CDS             complement(578309..579925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_498"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_498"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17327"
FT                   /db_xref="GOA:B1VQM6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM6"
FT                   /protein_id="BAG17327.1"
FT                   /translation="MTARSIRVAVAATMATALSLTAAACSNPDSARGGSGSGSASAVVG
FT                   IAYEPDSLSPLLGYGKDGNSKIFDGLLALDADMELRPALAAELPEISADGLTYTYKLRQ
FT                   GVKFSDGKPFGAKDVVFTYRTILDEKTNNASRTELDAVKDVTAKGEDTVVFTLKYPYAP
FT                   FAQRTVLPIAPQHIAGEQDVNTGAFTTKPVGTGPYVLTKWSKGEKLSFAANPDYWGGEP
FT                   EVKKFTMAIIKDDDVRATRLRSGDLDGAILPPNLAKGFADDQGKKTYAANSYDYRTVTL
FT                   PTANKVAGDTAVRRALDVAVDRQAMVDAILNGSGKPAYGPVPTDSEWFTKGTERPHDLA
FT                   AAKKILDEAGWKPGKDGVRVKDGVRATFPLWYLSGDKLRQEHALAYASDAKKAGIDIRT
FT                   EAGTWEVIEPRMKHDAVLAGGGSPADPDFDQYTLLKSSLAGDGFNNMAWYDNKAVDAAI
FT                   EAGRRSGDQAERKKAYDTVQRELVKNPGYTFLTHIDHLYVVDDRFGPLTTQVEPHDHGL
FT                   ASGPWWNVEKWSTENAGGSEK"
     MTARSIRVAV AATMATALSL TAAACSNPDS ARGGSGSGSA SAVVGIAYEP DSLSPLLGYG        60
     KDGNSKIFDG LLALDADMEL RPALAAELPE ISADGLTYTY KLRQGVKFSD GKPFGAKDVV       120
     FTYRTILDEK TNNASRTELD AVKDVTAKGE DTVVFTLKYP YAPFAQRTVL PIAPQHIAGE       180
     QDVNTGAFTT KPVGTGPYVL TKWSKGEKLS FAANPDYWGG EPEVKKFTMA IIKDDDVRAT       240
     RLRSGDLDGA ILPPNLAKGF ADDQGKKTYA ANSYDYRTVT LPTANKVAGD TAVRRALDVA       300
     VDRQAMVDAI LNGSGKPAYG PVPTDSEWFT KGTERPHDLA AAKKILDEAG WKPGKDGVRV       360
     KDGVRATFPL WYLSGDKLRQ EHALAYASDA KKAGIDIRTE AGTWEVIEPR MKHDAVLAGG       420
     GSPADPDFDQ YTLLKSSLAG DGFNNMAWYD NKAVDAAIEA GRRSGDQAER KKAYDTVQRE       480
     LVKNPGYTFL THIDHLYVVD DRFGPLTTQV EPHDHGLASG PWWNVEKWST ENAGGSEK         538
//

If you have problems or comments...

PBIL Back to PBIL home page