(data stored in ACNUC7421 zone)

EMBL: AP009493.PE499

AP009493.PE499       Location/Qualifiers
FT   CDS             complement(580078..580695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_499"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17328"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM7"
FT                   /protein_id="BAG17328.1"
FT                   /translation="MDCACGAIRSAPVGVCPWGAPAPGETTDKGVRRAMTDRDRRSVLR
FT                   LSSAAAITAGLVAGEGGIAHAARRAARRIVLTGRRTGANIPDVLTAGVPYFVRYELSDA
FT                   RGDSVGTENAHCLPVAVGLDGSFVVATLVLSLDDGLITAATGFERPLPAVTEPPVEARP
FT                   WSHLFAITGGTGAYTGASGSITIDHPARDEDVLTIDLAEASP"
     MDCACGAIRS APVGVCPWGA PAPGETTDKG VRRAMTDRDR RSVLRLSSAA AITAGLVAGE        60
     GGIAHAARRA ARRIVLTGRR TGANIPDVLT AGVPYFVRYE LSDARGDSVG TENAHCLPVA       120
     VGLDGSFVVA TLVLSLDDGL ITAATGFERP LPAVTEPPVE ARPWSHLFAI TGGTGAYTGA       180
     SGSITIDHPA RDEDVLTIDL AEASP                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page