(data stored in ACNUC7421 zone)

EMBL: AP009493.PE5

AP009493.PE5         Location/Qualifiers
FT   CDS             complement(5280..5813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_5t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_5t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16834"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK3"
FT                   /protein_id="BAG16834.1"
FT                   /translation="MPLVPFEEITHLFAEFEHTAFRLETRRGYATDRAGERFQAFQRGF
FT                   DPRPEPEHPWNVNVRDKAGQGAHFSRIRIVDEPPTDGQLFLIATAAGNVAAGEDIRVIS
FT                   RAVADSVGLPDYDFWLFDSRVLVRMHIDDTDTTTGVEVIEDPAAVLAACRARDTSWALA
FT                   VPTAQVWAQVRPPV"
     MPLVPFEEIT HLFAEFEHTA FRLETRRGYA TDRAGERFQA FQRGFDPRPE PEHPWNVNVR        60
     DKAGQGAHFS RIRIVDEPPT DGQLFLIATA AGNVAAGEDI RVISRAVADS VGLPDYDFWL       120
     FDSRVLVRMH IDDTDTTTGV EVIEDPAAVL AACRARDTSW ALAVPTAQVW AQVRPPV          177
//

If you have problems or comments...

PBIL Back to PBIL home page