(data stored in ACNUC7421 zone)

EMBL: AP009493.PE507

AP009493.PE507       Location/Qualifiers
FT   CDS             587949..589112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_507"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_507"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17336"
FT                   /db_xref="GOA:B1VQN5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQN5"
FT                   /protein_id="BAG17336.1"
FT                   /translation="MIRFEQVGKVYPDGTTAVDGLTFEVARGELVTLVGPSGCGKTTTM
FT                   MMVNRLIEPTSGRILVDGEDIAGVDPVKLRRRIGYVIQQVGLFPHRTVLDNTATVPALV
FT                   GWKRARARERAAELLDLVGLAPATYGSRYPAQLSGGQRQRVGVARALAADPPVLLMDEP
FT                   FGAVDPVVREHLQNEFLALQQRVRKTVLLVTHDIEEAVRMGDRIAVYGEGRIEQFDTPA
FT                   AVLGTPATPYVARFVGSDRGLKRLSVTAIEPEDLEEPPVARLEERAGAAAARLAAAGAR
FT                   WAVVLNGAGELHGWVSADALRSSGEEGTVGGLARRMDAWVPVGAPLKQAFSEMLQHDAG
FT                   WVAVLDGARFLGVLTPAKLHEALRRSVDADAQGVGREEVDFDSVADA"
     MIRFEQVGKV YPDGTTAVDG LTFEVARGEL VTLVGPSGCG KTTTMMMVNR LIEPTSGRIL        60
     VDGEDIAGVD PVKLRRRIGY VIQQVGLFPH RTVLDNTATV PALVGWKRAR ARERAAELLD       120
     LVGLAPATYG SRYPAQLSGG QRQRVGVARA LAADPPVLLM DEPFGAVDPV VREHLQNEFL       180
     ALQQRVRKTV LLVTHDIEEA VRMGDRIAVY GEGRIEQFDT PAAVLGTPAT PYVARFVGSD       240
     RGLKRLSVTA IEPEDLEEPP VARLEERAGA AAARLAAAGA RWAVVLNGAG ELHGWVSADA       300
     LRSSGEEGTV GGLARRMDAW VPVGAPLKQA FSEMLQHDAG WVAVLDGARF LGVLTPAKLH       360
     EALRRSVDAD AQGVGREEVD FDSVADA                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page