(data stored in ACNUC7421 zone)

EMBL: AP009493.PE512

AP009493.PE512       Location/Qualifiers
FT   CDS             complement(592615..593289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_512"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_512"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17341"
FT                   /db_xref="GOA:B1VQP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQP0"
FT                   /protein_id="BAG17341.1"
FT                   /translation="MNTLSETWSWLTTAAHWSGPDGIGNRLGEHLYLTVVCLLISCLVA
FT                   LPVALVLGHLGKGGALAVNLSNIGRAVPTFAVLVLLLLTPLGTRGQWSTVIALVLFAVP
FT                   PLLTNAYVGMREVDRDVVRAARGMGMTGRQLLLGVELPLALPLILTGVRIAAVQLVATA
FT                   TIAALAGGGGLGRIITAGFNLASTPQVVAGAVLVAAFALLVEGLFEAGRRLAPRRGRAA
FT                   AP"
     MNTLSETWSW LTTAAHWSGP DGIGNRLGEH LYLTVVCLLI SCLVALPVAL VLGHLGKGGA        60
     LAVNLSNIGR AVPTFAVLVL LLLTPLGTRG QWSTVIALVL FAVPPLLTNA YVGMREVDRD       120
     VVRAARGMGM TGRQLLLGVE LPLALPLILT GVRIAAVQLV ATATIAALAG GGGLGRIITA       180
     GFNLASTPQV VAGAVLVAAF ALLVEGLFEA GRRLAPRRGR AAAP                        224
//

If you have problems or comments...

PBIL Back to PBIL home page