(data stored in ACNUC7421 zone)

EMBL: AP009493.PE513

AP009493.PE513       Location/Qualifiers
FT   CDS             complement(593315..593992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_513"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_513"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17342"
FT                   /db_xref="GOA:B1VQP1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQP1"
FT                   /protein_id="BAG17342.1"
FT                   /translation="MTAPPDDCLARNEWICGAYLSSRREILVDAVLQHLQLTGAAVAVA
FT                   LLLAVPLAVAARRWRWAAGPVLGLTTILYTIPSLAMFSLLLPRYGLSAALVIAGLVLYS
FT                   LTLLVRNILAGLRAVPEETRQAARGMGYGPLRLLLAVELPLALPAAMAGLRIATVSAVS
FT                   LVTIGAIVGHGGLGNLIYSGMNTYFKAQVLTASVLCVVIAVAADLLLLGAGRLLTPWTR
FT                   RRA"
     MTAPPDDCLA RNEWICGAYL SSRREILVDA VLQHLQLTGA AVAVALLLAV PLAVAARRWR        60
     WAAGPVLGLT TILYTIPSLA MFSLLLPRYG LSAALVIAGL VLYSLTLLVR NILAGLRAVP       120
     EETRQAARGM GYGPLRLLLA VELPLALPAA MAGLRIATVS AVSLVTIGAI VGHGGLGNLI       180
     YSGMNTYFKA QVLTASVLCV VIAVAADLLL LGAGRLLTPW TRRRA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page