(data stored in ACNUC7421 zone)

EMBL: AP009493.PE515

AP009493.PE515       Location/Qualifiers
FT   CDS             594426..595484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_515"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17344"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQP3"
FT                   /protein_id="BAG17344.1"
FT                   /translation="MQTKALAPEYQGALTKMSVNASLTDVLAEGVRHLRQAELSGSQEE
FT                   VARSGLAVAEAHRRLGQVAEADRAWKASYRAARTAGNTGAMAWALWSGGTLARQRGSLR
FT                   LAFRLLGLAAELGKRGGDVVARGYSLAGLAETGRIQGDYATVATLHEQLLAEARARGEA
FT                   RHTVWALEGIAQIHRNTGSLDTALEMFEEAAVLAGDADDRRGRAWALRGIADIVSLRDG
FT                   ATGRALDLLSEAEVTCREMNLSSALAYNHKMRANVFFRAGRYEEAREVYEQALGEFRAM
FT                   DEPRGEALASLGLVKARARLGRDRAATASDLDGLRDRLSRIGLLNAQEMVEKAYAELGV
FT                   EPASASERDGRR"
     MQTKALAPEY QGALTKMSVN ASLTDVLAEG VRHLRQAELS GSQEEVARSG LAVAEAHRRL        60
     GQVAEADRAW KASYRAARTA GNTGAMAWAL WSGGTLARQR GSLRLAFRLL GLAAELGKRG       120
     GDVVARGYSL AGLAETGRIQ GDYATVATLH EQLLAEARAR GEARHTVWAL EGIAQIHRNT       180
     GSLDTALEMF EEAAVLAGDA DDRRGRAWAL RGIADIVSLR DGATGRALDL LSEAEVTCRE       240
     MNLSSALAYN HKMRANVFFR AGRYEEAREV YEQALGEFRA MDEPRGEALA SLGLVKARAR       300
     LGRDRAATAS DLDGLRDRLS RIGLLNAQEM VEKAYAELGV EPASASERDG RR               352
//

If you have problems or comments...

PBIL Back to PBIL home page