(data stored in ACNUC7421 zone)

EMBL: AP009493.PE52

AP009493.PE52        Location/Qualifiers
FT   CDS             complement(54853..55542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_52t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_52t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16881"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLY0"
FT                   /protein_id="BAG16881.1"
FT                   /translation="MNRRMITVLALAAAVLASAAPATAVSAPTAVRAAPVAEVTTLADA
FT                   VGQVKVTEEDRTGYTRSSFRHWNAGENATDGCNTRAEVLLAEAVVAPTVGAGCKLTGGT
FT                   WTSYYDGQEVTSAGALDIDHMVPLAEAWDSGASAWTPARREAYANDQGAEVSLVAVTAR
FT                   SNRQKSDQDPADWMPPSPDAQCRYIGEWVSTKLRWQLTADDRELEALKVYADGPCENTI
FT                   VRYTPAA"
     MNRRMITVLA LAAAVLASAA PATAVSAPTA VRAAPVAEVT TLADAVGQVK VTEEDRTGYT        60
     RSSFRHWNAG ENATDGCNTR AEVLLAEAVV APTVGAGCKL TGGTWTSYYD GQEVTSAGAL       120
     DIDHMVPLAE AWDSGASAWT PARREAYAND QGAEVSLVAV TARSNRQKSD QDPADWMPPS       180
     PDAQCRYIGE WVSTKLRWQL TADDRELEAL KVYADGPCEN TIVRYTPAA                   229
//

If you have problems or comments...

PBIL Back to PBIL home page