(data stored in ACNUC7421 zone)

EMBL: AP009493.PE520

AP009493.PE520       Location/Qualifiers
FT   CDS             600208..601566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17349"
FT                   /db_xref="GOA:B1VQP8"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQP8"
FT                   /protein_id="BAG17349.1"
FT                   /translation="MAAVLTPPAPSAAAGPRATVRFPWSGLRSRWPLLPLVATVLLPAL
FT                   PSGAWGGAGPADVASALAVLVCAGRLLYLRQRPLSGTAPLVLGLPAVGFAVATVTAADP
FT                   AAALPGLVRYLQVFVLVPTAVYLLLRDAHGFRIVAGSLALLAVVQGVTGVHQYVTGTGA
FT                   SYMGEDIRAVGTFGPSDIMGMATVVAYGLLAAAACALRAPRNAPGPLRPCAAVLAVALV
FT                   VPLTLSFSRGVWVATVAALLVVLALAGRRQALTALAVLGAAGVVLVGGLGIGSEMIADR
FT                   AASVTRVTSTPDRSVSDRYALWGAAGAMWRERPATGVGLKGFPAHRDGHASIGLSSGSD
FT                   TAGAGQEFRRQALLSPHNMYLLVLGEQGLIGLTALVGSWAALLVGAVRRLYVARSRGHA
FT                   AVDCGLAAVALMTWQSVNFLYADIGGPTTVLSGIVLGLAAWWALAGPDRVSTV"
     MAAVLTPPAP SAAAGPRATV RFPWSGLRSR WPLLPLVATV LLPALPSGAW GGAGPADVAS        60
     ALAVLVCAGR LLYLRQRPLS GTAPLVLGLP AVGFAVATVT AADPAAALPG LVRYLQVFVL       120
     VPTAVYLLLR DAHGFRIVAG SLALLAVVQG VTGVHQYVTG TGASYMGEDI RAVGTFGPSD       180
     IMGMATVVAY GLLAAAACAL RAPRNAPGPL RPCAAVLAVA LVVPLTLSFS RGVWVATVAA       240
     LLVVLALAGR RQALTALAVL GAAGVVLVGG LGIGSEMIAD RAASVTRVTS TPDRSVSDRY       300
     ALWGAAGAMW RERPATGVGL KGFPAHRDGH ASIGLSSGSD TAGAGQEFRR QALLSPHNMY       360
     LLVLGEQGLI GLTALVGSWA ALLVGAVRRL YVARSRGHAA VDCGLAAVAL MTWQSVNFLY       420
     ADIGGPTTVL SGIVLGLAAW WALAGPDRVS TV                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page