(data stored in ACNUC7421 zone)

EMBL: AP009493.PE521

AP009493.PE521       Location/Qualifiers
FT   CDS             601563..603269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_521"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17350"
FT                   /db_xref="GOA:B1VQP9"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQP9"
FT                   /protein_id="BAG17350.1"
FT                   /translation="MSDAGTGTGTRAGARPAHAAAPPPLPAPGGGAEGPLSPGTGGGEA
FT                   PRLGSFLARAAAGTAVLTVLGAVLGLVRDQAIARYFGASDASDAFLIAWTVPEMAATLL
FT                   IEDGMALLLVPAFSLALTRRAAAGETPGSDPVRDLVATTLPRLFLLLSGGAALLIAGAP
FT                   WVVGLLAPGLADPRLAVDCTRLTSVTVLTFGITGYFSAALRAHRSFLPPAGVYAAYNLG
FT                   IIGMTLALHAAWGVRAAAVGVAVGSVLMILTQLPVFLRLVPLARPRPPRFRRGRRAART
FT                   APLLGFAVLAPVVLFVVSRQSQVLVERFLASTLPAGAISHLNYAQKVAQMPMVLSLMIC
FT                   TVTFPVVAQAMAAGDRERARLRVERDLALAGMVVLLGTAVVLGYAPQIIEVLFQRGAFD
FT                   PADTASTAQVMRVYALGLLGHCLVGALSRPFFSSGRPTWFPAFAMGTGLLVTTGAGYAL
FT                   TYRFGVDGIATANALGISSTALLLLMGLGTRVVPIRARAVALSLGRLAGASLAAGAAGW
FT                   ACAPLVPDPVLSLAVGCLLVPAVFFLTGLALRSPEVVSLLALTRRRFLDGR"
     MSDAGTGTGT RAGARPAHAA APPPLPAPGG GAEGPLSPGT GGGEAPRLGS FLARAAAGTA        60
     VLTVLGAVLG LVRDQAIARY FGASDASDAF LIAWTVPEMA ATLLIEDGMA LLLVPAFSLA       120
     LTRRAAAGET PGSDPVRDLV ATTLPRLFLL LSGGAALLIA GAPWVVGLLA PGLADPRLAV       180
     DCTRLTSVTV LTFGITGYFS AALRAHRSFL PPAGVYAAYN LGIIGMTLAL HAAWGVRAAA       240
     VGVAVGSVLM ILTQLPVFLR LVPLARPRPP RFRRGRRAAR TAPLLGFAVL APVVLFVVSR       300
     QSQVLVERFL ASTLPAGAIS HLNYAQKVAQ MPMVLSLMIC TVTFPVVAQA MAAGDRERAR       360
     LRVERDLALA GMVVLLGTAV VLGYAPQIIE VLFQRGAFDP ADTASTAQVM RVYALGLLGH       420
     CLVGALSRPF FSSGRPTWFP AFAMGTGLLV TTGAGYALTY RFGVDGIATA NALGISSTAL       480
     LLLMGLGTRV VPIRARAVAL SLGRLAGASL AAGAAGWACA PLVPDPVLSL AVGCLLVPAV       540
     FFLTGLALRS PEVVSLLALT RRRFLDGR                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page