(data stored in ACNUC7421 zone)

EMBL: AP009493.PE524

AP009493.PE524       Location/Qualifiers
FT   CDS             605201..605872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_524"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17353"
FT                   /db_xref="GOA:B1VRD5"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRD5"
FT                   /protein_id="BAG17353.1"
FT                   /translation="MTDSPEQQRHITVRRLRTALARLPHWWPLPVCVLIGTASGLSYGA
FT                   LAADRYEATSYAMAVAEGETDPSAALGYAQSYGRLTTSDATLSYAQGAAGEPVRELRSH
FT                   VRSETSPDSPMIAVTGTSEDRRRAADIANAVIEAVIVSSGHVADDTGVKLIKFTHAMTP
FT                   DRPVSPSVPLGGAVGAATGGLLGGLVLLVRPRRAARPVAAQVPGPTAGGGVAQDDRELV
FT                   R"
     MTDSPEQQRH ITVRRLRTAL ARLPHWWPLP VCVLIGTASG LSYGALAADR YEATSYAMAV        60
     AEGETDPSAA LGYAQSYGRL TTSDATLSYA QGAAGEPVRE LRSHVRSETS PDSPMIAVTG       120
     TSEDRRRAAD IANAVIEAVI VSSGHVADDT GVKLIKFTHA MTPDRPVSPS VPLGGAVGAA       180
     TGGLLGGLVL LVRPRRAARP VAAQVPGPTA GGGVAQDDRE LVR                         223
//

If you have problems or comments...

PBIL Back to PBIL home page