(data stored in ACNUC7421 zone)

EMBL: AP009493.PE525

AP009493.PE525       Location/Qualifiers
FT   CDS             605869..607017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_525"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17354"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRD6"
FT                   /protein_id="BAG17354.1"
FT                   /translation="MTGRRAGGLVVTLCRDFGEFGALAGEWDALHRRCATATPFQSHAW
FT                   LHSWWISYGQEGRLRVLLVRRAGRLIGAAPLMLVHRPMPLLVPMGGAISDFFDILLDEE
FT                   EAGYAVGALGRGLDRAARHTVVDLREVRPDASAQLLFGRWAGARSRLTDSTCMELPAEP
FT                   LGDFVAGLTGSRGQRLRSKLRKVEALGVEAHRVPRDGVPAAIGTLLRLHERQWEGRGVN
FT                   PEHLRSRFSDHLVRSVGRMVGDGTAAMTEFRLNGAVVASNLSLQSGRLTGGYLYGADPA
FT                   LRERKVDVSTMLLREVAQQASDGGRTVLSLLRGAESYKNHWGPVPVVNQRLLLARPGLE
FT                   PLLRLRESQVAVRERAVETVKARFPAARDWHERLSGLPVIGR"
     MTGRRAGGLV VTLCRDFGEF GALAGEWDAL HRRCATATPF QSHAWLHSWW ISYGQEGRLR        60
     VLLVRRAGRL IGAAPLMLVH RPMPLLVPMG GAISDFFDIL LDEEEAGYAV GALGRGLDRA       120
     ARHTVVDLRE VRPDASAQLL FGRWAGARSR LTDSTCMELP AEPLGDFVAG LTGSRGQRLR       180
     SKLRKVEALG VEAHRVPRDG VPAAIGTLLR LHERQWEGRG VNPEHLRSRF SDHLVRSVGR       240
     MVGDGTAAMT EFRLNGAVVA SNLSLQSGRL TGGYLYGADP ALRERKVDVS TMLLREVAQQ       300
     ASDGGRTVLS LLRGAESYKN HWGPVPVVNQ RLLLARPGLE PLLRLRESQV AVRERAVETV       360
     KARFPAARDW HERLSGLPVI GR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page