(data stored in ACNUC7421 zone)

EMBL: AP009493.PE53

AP009493.PE53        Location/Qualifiers
FT   CDS             complement(55937..56413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_53t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_53t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16882"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLY1"
FT                   /protein_id="BAG16882.1"
FT                   /translation="MAAEEHAPDYPPKTPPPPKRPVSPPRPETSLAGTARARMQVRNRR
FT                   SANWSLEAAAWSPRKASGFVLGRLHEWGYREVDEAAAALTELLVLTAVADGGRRVSVHL
FT                   ADQKRQALIVALSHQPGLAAADTRVLPELTRLGAVSCGTDTADDGRRVWAVLDL"
     MAAEEHAPDY PPKTPPPPKR PVSPPRPETS LAGTARARMQ VRNRRSANWS LEAAAWSPRK        60
     ASGFVLGRLH EWGYREVDEA AAALTELLVL TAVADGGRRV SVHLADQKRQ ALIVALSHQP       120
     GLAAADTRVL PELTRLGAVS CGTDTADDGR RVWAVLDL                               158
//

If you have problems or comments...

PBIL Back to PBIL home page