(data stored in ACNUC7421 zone)

EMBL: AP009493.PE530

AP009493.PE530       Location/Qualifiers
FT   CDS             610540..611793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_530"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17359"
FT                   /db_xref="GOA:B1VRE1"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRE1"
FT                   /protein_id="BAG17359.1"
FT                   /translation="MPAKRRLIVSCIAAAALSLLAGGGIAGQSPPGADSVDGAAPGAPR
FT                   AASSTAHGAYLDYGPAGVSRMAELSRWLGGAELRVGHTYLPGDLWVNIEGAPDFLDAWA
FT                   DWRQADPARMFVLNVPMLERNEERVPDAEVRTLLRAGAAGEYDQHFSRLAERLVELGVP
FT                   DTVIVLGWEMNGTTYTHRCGPDPASWKAYWQRIVTAMRAVPGQDFRFDFTPSRGRDAVP
FT                   WTECYPGDDVVDIIGMDSYDQPPGETFDDQVTDPYGLQKHVDFAAEHGKPISFPEWGLF
FT                   RNGDNPEYMRRMLEWIDRHKPLYQTVTDYCPHGVWQCKSNPRSSRVFRTMLTEMAAPAA
FT                   PTPSPAPTPTPTPPPTAAPTVPAPSPTVEPSVAPSPAPPAPTEPAAGAPTVREWCVPVP
FT                   FGDWLGPWLREREICFRY"
     MPAKRRLIVS CIAAAALSLL AGGGIAGQSP PGADSVDGAA PGAPRAASST AHGAYLDYGP        60
     AGVSRMAELS RWLGGAELRV GHTYLPGDLW VNIEGAPDFL DAWADWRQAD PARMFVLNVP       120
     MLERNEERVP DAEVRTLLRA GAAGEYDQHF SRLAERLVEL GVPDTVIVLG WEMNGTTYTH       180
     RCGPDPASWK AYWQRIVTAM RAVPGQDFRF DFTPSRGRDA VPWTECYPGD DVVDIIGMDS       240
     YDQPPGETFD DQVTDPYGLQ KHVDFAAEHG KPISFPEWGL FRNGDNPEYM RRMLEWIDRH       300
     KPLYQTVTDY CPHGVWQCKS NPRSSRVFRT MLTEMAAPAA PTPSPAPTPT PTPPPTAAPT       360
     VPAPSPTVEP SVAPSPAPPA PTEPAAGAPT VREWCVPVPF GDWLGPWLRE REICFRY          417
//

If you have problems or comments...

PBIL Back to PBIL home page