(data stored in ACNUC7421 zone)

EMBL: AP009493.PE531

AP009493.PE531       Location/Qualifiers
FT   CDS             612010..614475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_531"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17360"
FT                   /db_xref="GOA:B1VRE2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRE2"
FT                   /protein_id="BAG17360.1"
FT                   /translation="MASADEGSPAEPGPLPSGDGREPVRTTDGAAAVIAGDGTVIGWTR
FT                   GAEALLGYPAAEVVGRSASQLLAGPPDARRTAAVAARCRAGSGWSGLVPLRARDGRSLD
FT                   IDVRVTASFLIAGREGFLVSGRELTPHWTMRGSVLDDFLTRSPVGMAVLDPELRYLWLN
FT                   DTLERFGGVPREQRLGRRPGDVLPEALAAPIERLMRQVLSTGEAITDYEYLGWSWADPH
FT                   RRRAYASSFFPLADARDRRIGVGYMVLDVTDRWNARRLLSLVNEAGASIGSTLDVQRTA
FT                   QELADFAVPRFADFVFVDLLENPFGGDRRGAVAPAEGERPAMRRAGMSSVREGCPEAVV
FT                   RVGETVDFVPPPHDAHFLLDGDPVLLPALDPDSHGWTVEQPARAARLREFGLHSLISVP
FT                   MRARDTVLGLTTFMRSRNPVPFDEDDVAPARELVARAAVCVDNARRYTREHTAALVLQR
FT                   SLLPHTLRGGTALDVASSYLPADAKDGVGGDWFDVIPLSGARVGLVIGDVVGHGIGAAA
FT                   TMGRLRTAVQTLADMDLPPDELLARLDDLVLRLSEEEGAGGPAERGGTTVVGATCLYAV
FT                   YDPSNGCCTMARAGHPPPVIVTPDDGVHFPDLPSGPPLGLGGLPFEALEIELPEGSLLG
FT                   LYTDGLIEGADKDLERGMERLGRALSRAGVPLDELCPAVVGELVPVPQPDDIAFLLART
FT                   HRLSPEHLVSWDVPVDPAAVGETRAKVSRRLEAWGLAELSMTTELIVSELVTNAIRYGE
FT                   GPVRLRLLFQSALTCEVSDASNTSPRLRHARTTDEGGRGLFLVAQLAHRWGTRYTPRGK
FT                   IIWAEQPLP"
     MASADEGSPA EPGPLPSGDG REPVRTTDGA AAVIAGDGTV IGWTRGAEAL LGYPAAEVVG        60
     RSASQLLAGP PDARRTAAVA ARCRAGSGWS GLVPLRARDG RSLDIDVRVT ASFLIAGREG       120
     FLVSGRELTP HWTMRGSVLD DFLTRSPVGM AVLDPELRYL WLNDTLERFG GVPREQRLGR       180
     RPGDVLPEAL AAPIERLMRQ VLSTGEAITD YEYLGWSWAD PHRRRAYASS FFPLADARDR       240
     RIGVGYMVLD VTDRWNARRL LSLVNEAGAS IGSTLDVQRT AQELADFAVP RFADFVFVDL       300
     LENPFGGDRR GAVAPAEGER PAMRRAGMSS VREGCPEAVV RVGETVDFVP PPHDAHFLLD       360
     GDPVLLPALD PDSHGWTVEQ PARAARLREF GLHSLISVPM RARDTVLGLT TFMRSRNPVP       420
     FDEDDVAPAR ELVARAAVCV DNARRYTREH TAALVLQRSL LPHTLRGGTA LDVASSYLPA       480
     DAKDGVGGDW FDVIPLSGAR VGLVIGDVVG HGIGAAATMG RLRTAVQTLA DMDLPPDELL       540
     ARLDDLVLRL SEEEGAGGPA ERGGTTVVGA TCLYAVYDPS NGCCTMARAG HPPPVIVTPD       600
     DGVHFPDLPS GPPLGLGGLP FEALEIELPE GSLLGLYTDG LIEGADKDLE RGMERLGRAL       660
     SRAGVPLDEL CPAVVGELVP VPQPDDIAFL LARTHRLSPE HLVSWDVPVD PAAVGETRAK       720
     VSRRLEAWGL AELSMTTELI VSELVTNAIR YGEGPVRLRL LFQSALTCEV SDASNTSPRL       780
     RHARTTDEGG RGLFLVAQLA HRWGTRYTPR GKIIWAEQPL P                           821
//

If you have problems or comments...

PBIL Back to PBIL home page