(data stored in ACNUC7421 zone)

EMBL: AP009493.PE534

AP009493.PE534       Location/Qualifiers
FT   CDS             complement(618054..619571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_534"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17363"
FT                   /db_xref="GOA:B1VRE5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRE5"
FT                   /protein_id="BAG17363.1"
FT                   /translation="MKERAAMPDTPERAAAPGREAGTVLPAAPDLLPEALADARSPRAP
FT                   ELSPYVPERPFPWNGPVTPYAGEPGTAIDLDRVLRLSLAAPAGTPGRLRPVPSAGALHP
FT                   VRAHLLLGSGCSLPPGRYVYDPRAHRAHRRGPAPDGIPPGALAVLTVAASRTVAHYGHR
FT                   AWPLLLLDTGHAAAALALAGATTADVLVSLDADGPLLSAAAGLPEAPEWQDVWPGTEPE
FT                   LPLAAVRLTHPGSPVEAGPPLSAWAARSRASAPTPQPGADATPPRGLAAARHLLHHIAA
FT                   VRGRPDGTWHPAPRTGEPTDQDLLTRRSAPPEDLNRPPEKELLSRILATAERVLPEGPA
FT                   WTVALGGATPGLYAAAPGRPGLAVRAVGDARPTLAHWAAGQHWIGTAGAVLLAHGCPED
FT                   APRATVRSSHLAAGYAVGAAQAHATALGLRSRPIGSWQQADLGAALGGTPGREWIVHGL
FT                   ALGAPPTTAATPATTAATAAATSAPAATTPPTASAAPATPPGEEERP"
     MKERAAMPDT PERAAAPGRE AGTVLPAAPD LLPEALADAR SPRAPELSPY VPERPFPWNG        60
     PVTPYAGEPG TAIDLDRVLR LSLAAPAGTP GRLRPVPSAG ALHPVRAHLL LGSGCSLPPG       120
     RYVYDPRAHR AHRRGPAPDG IPPGALAVLT VAASRTVAHY GHRAWPLLLL DTGHAAAALA       180
     LAGATTADVL VSLDADGPLL SAAAGLPEAP EWQDVWPGTE PELPLAAVRL THPGSPVEAG       240
     PPLSAWAARS RASAPTPQPG ADATPPRGLA AARHLLHHIA AVRGRPDGTW HPAPRTGEPT       300
     DQDLLTRRSA PPEDLNRPPE KELLSRILAT AERVLPEGPA WTVALGGATP GLYAAAPGRP       360
     GLAVRAVGDA RPTLAHWAAG QHWIGTAGAV LLAHGCPEDA PRATVRSSHL AAGYAVGAAQ       420
     AHATALGLRS RPIGSWQQAD LGAALGGTPG REWIVHGLAL GAPPTTAATP ATTAATAAAT       480
     SAPAATTPPT ASAAPATPPG EEERP                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page