(data stored in ACNUC7421 zone)

EMBL: AP009493.PE537

AP009493.PE537       Location/Qualifiers
FT   CDS             complement(622557..623486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_537"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17366"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRE8"
FT                   /protein_id="BAG17366.1"
FT                   /translation="MLRTSGGEFLRVDTGGVTGEALVRRLAGQEEAPDEGGNAAELDRL
FT                   VQAFEAAGYAVSAPPRAPLAGRTVHVLGDPVLAEPLARCAGAEGAEVHRITPDRVAELV
FT                   RAAPDPRVVGRVAVVWCLDSPVPEGLWDAADLLPGRRVAWLRCHREGAHSWTEPLAATP
FT                   GDVTSRHVRLRRLAATPAHRELAAYWAGHRTPDTGPHPTEASAALIAALLTADLLAWAE
FT                   AEAEAEVEERAGAGAGARIEAGAEPEAGARAAAEPGARVLPVRRRLRRIDLRALTFTEH
FT                   PVLPVPDVAPLPAPAPARAGTGVAGARP"
     MLRTSGGEFL RVDTGGVTGE ALVRRLAGQE EAPDEGGNAA ELDRLVQAFE AAGYAVSAPP        60
     RAPLAGRTVH VLGDPVLAEP LARCAGAEGA EVHRITPDRV AELVRAAPDP RVVGRVAVVW       120
     CLDSPVPEGL WDAADLLPGR RVAWLRCHRE GAHSWTEPLA ATPGDVTSRH VRLRRLAATP       180
     AHRELAAYWA GHRTPDTGPH PTEASAALIA ALLTADLLAW AEAEAEAEVE ERAGAGAGAR       240
     IEAGAEPEAG ARAAAEPGAR VLPVRRRLRR IDLRALTFTE HPVLPVPDVA PLPAPAPARA       300
     GTGVAGARP                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page