(data stored in ACNUC7421 zone)

EMBL: AP009493.PE538

AP009493.PE538       Location/Qualifiers
FT   CDS             complement(623702..623851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_538"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17367"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRE9"
FT                   /protein_id="BAG17367.1"
FT                   /translation="METQLMENNTVFSPIADQGQLAHLSATHSNALVENPFDDAVEADT
FT                   AAEK"
     METQLMENNT VFSPIADQGQ LAHLSATHSN ALVENPFDDA VEADTAAEK                    49
//

If you have problems or comments...

PBIL Back to PBIL home page